PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS60905.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family BES1
Protein Properties Length: 325aa    MW: 34703.6 Da    PI: 8.5854
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS60905.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822197.73.7e-61141421133
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslk 99 
                 g+++rkp+ +ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++p   +e +g+sa+++p+ss + s+ 
  EPS60905.1  14 GTGRRKPSCRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCTEAGWIVEPDGTTYRKGCRPS-PMELGGTSATITPSSSRNPSPP 111
                 5799***********************************************************************9.********************** PP

      DUF822 100 ssalaspvesysaspksssfpspssldsislasa 133
                 ss++asp   y++sp+sssfpsps    + l+s+
  EPS60905.1 112 SSYFASP---YQPSPSSSSFPSPSCPAANALSSH 142
                 *****98...89************9888888754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056877.3E-5616133IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
GGGGSTASSA DGGGTGRRKP SCRERENNRR RERRRRAIAA KIYAGLRAQG NYNLPKHCDN  60
NEVLKALCTE AGWIVEPDGT TYRKGCRPSP MELGGTSATI TPSSSRNPSP PSSYFASPYQ  120
PSPSSSSFPS PSCPAANALS SHPFAFLLNS IPSSSSSPLP PLRISNSAPV TPPLSSPRKL  180
LPIQNSESFA KESISALNNV PFFAASAPAS PIRGHRFTPV TIPECDESDS STIDSGQWIN  240
FQTYANAIPT SPTFNLIRPM ARVVLPSSSQ EPMAIDNDSS KGKGKEFELD NNSSDLAVKP  300
WEGERIHDVG MDDLELTLGN GNTRV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11635RRKPSCRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-135PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-101BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLS8C2A70.0S8C2A7_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000398791e-120(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-74BES1 family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]